Daegu subway map. Station Distance; Dong-gu Office: 0.
Daegu subway map org Metropolitana di Daegu; Usage on mt. Through NAVER Map, you can access subway maps for all of South Korea. This app is designed to meet the needs of both locals and tourists, offering a wide range of features and capabilities for Daegu Metro Map. A network with 6 lines to be built in 3 stages is planned. January 22, 2019 May 6, 2021 by lastomar. On this map, you can easily find the KTX stations, bus terminal stations, and Daegu Airport. kr. Daegu Subway zones map. Phone 1800 1472 Website srail. Krećite se podzemnom željeznicom u Daeguu s informacijama u stvarnom vremenu, rutama i ažuriranim vremenskim prilikama. The latest subway maps of Seoul Metropolitan Area, Busan, Daegu, Daejeon, and Gwangju. ), 계명대역, 성서산업단지역 (Seongseo Industrial Complex Stn. Enfants. Rome2Rio makes travelling from Yeungnam University to Dongdaegu Station easy. org Métro de Daegu; Usage on it. Metro lines via Daegu Station. The subway of the South Korean city of Daegu first received passengers in 1997. Station Distance; Dong-gu Office: 0. 4 mi: Chilseong Market: 0. search. 1. - Essential application for traveling Korea, Seoul, Busan, Daejun, Gwangju, Daegu. This app is designed to meet the needs of both locals and tourists, offering a wide range of features and capabilities for Find local businesses, view maps and get driving directions in Google Maps. Perfect for both residents and visitors alike, with the added convenience of live Daegu; Usage on en. 8 km / 0. This app is designed to meet the needs of both locals and tourists, offering a wide range of features and capabilities for convenient and comfortable travel in the Korean Subway 3. Use the train timetable to mark the train location on the route map. You are free: to share – to copy, distribute and transmit the work; to remix – to adapt the work; Under the following conditions: attribution – You must give appropriate credit, provide a link to the license, and indicate if changes were made. To use Subway function, please click on the hamburger icon at the top left corner to access the Subway menu. Other Lines. Zaloguj się przez Google; play_apps Biblioteka i urządzenia; Πλοηγηθείτε στο μετρό του Daegu με πληροφορίες, διαδρομές και ενημερώσεις για τον καιρό σε πραγματικό χρόνο. The line color is scarlet. help_outline. Metro lines via Dongdaegu Station. Daegu Metro Line 3 is a monorail line, and Hitachi Monorail was contracted for the supply of monorail, track switches and signalling system. Bus: Just like subway, buses also use T-Money card payment method. Rome2Rio is a door-to-door travel information and booking engine, helping you get to and from any location in the world. Daegu station is a station on the Gyeongbu Line and Daegu Metro Line 1 in Chilseong-dong, Buk District, Daegu, South Korea. Pel·lícules. Dla dzieci. The line first began running from Munyang to Sawol on 18 October 2005, a distance of 29 km (18 mi). Try our subway maps reflecting real locations. Daegu Bed and Breakfast Daegu Vacation Rentals Flights to Daegu Daegu Download Daegu Subway Map and enjoy it on your iPhone, iPad and iPod touch. Station Distance; Banwoldang: 0. KTX Honam Line. By 늘근루키 | 2024-11-24T15:22:23+09:00 June 21st, 2020 | Railroad Route Map | Comments Off on Railroad Map of South Korea Share this page SUBWAY. Today. The line runs from Yongsan Station in the capital (Seoul) to Gwangju and Mokpo in the southwest Daegu subway map | daegu blog. See the map, lines, stations, fares and other information about Daegu Metro on this web page. Jeju-do | Map. Station Distance; Jungangno: 0. Line 1 (Seolhwa-Myeonggok - Ansim) Preceding station: Myeongdeok: Following station: Jungangno: Line 2 (Munyang - Yeungnam Univ. Danimbackpackers is located in downtown Daegu near the Banwoldang Subway Station, Daegu's central subway station where both subway lines intersect. Daegu Metro is a three-line underground rapid transit system connecting different corners of Daegu, the third largest metropolitan area in South Korea. Games. Jocs. Facebook X WhatsApp Tumblr Pinterest Vk Email. Navigujte metrem Daegu s informacemi v reálném čase, trasami a aktualizacemi počasí. Today, the Daegu subway has two full-fledged subway routes with 59 stations. 60364797552663 | * Line 1: (Metro/rapid transit, 22 stations) HOLLYS COFFEE, 다사역 (Dasa Stn. May 4, 2016 - Updated Daegu Subway map. 9 km / 0. none. The two metro lines operate in a flattened ‘x’ shape running east to west/south west. Banwoldang metro station. By LookatKorea January 13, 2020 January 27, 2022. Daegu Station metro station. KTX High-Speed Train Map. - From main subway route map (Seoul subway route map, Busan subway route map, Daejun subway route map, Gwangju subway route map, Daegu subway route map), it is possible to find the exact route even to the exit number by setting the final destination. Banwoldang metro station's location and serving lines in Daegu Metro system map. The section from Jungnangno to Ansim was opened shortly thereafter, on May 2, 1998. Provides the latest subway map of Seoul, Busan, Daegu, Daejeon, and Gwangju Multi-language support: English, Korean, and Japanese Vector-based maps that provide a clear image quality at any zoom level All subway maps provide real-time transit info, timetable, transfer info, station/area guide, and so on. When autocomplete results are available use up and down arrows to review and enter to select. Afterwards , the plan was changed to the Daegu Industrial Line, not the extension of Line 1, and it was selected as an exemption project from the preliminary 1. Metro lines via Jungangno. wikivoyage. Watch. route maps, journey times and estimated fares from relevant transport operators, ensuring you can make an informed decision about which option will suit you best. ) Korean Subway 3. Hry. By public transportation [edit] Daegu has three subway metro lines. Dongdaegu Station metro station. Metro lines via Banwoldang. Station to Kyungpook National University Hospital Station right here. so i will make Navigujte v metre Daegu s informáciami v reálnom čase, trasami a aktualizáciami počasia. Train from Suseo SRT to Dongdaegu Station Ave. Navigate the city with confidence, using detailed maps whenever you need them. Line 3 is a above-ground monorail which is unique for Korea’s subway lines. Daegu has a three-line subway network that intersects at three places; Myeongdeok, Sinnam and the main downtown stop Banwoldang. You can find these key locations by the colored circles. It takes 5 minutes on foot to Introducing the innovative "Explore Daegu Metro" app, your indispensable companion for navigating Daegu's public transportation system. Line 1 (Seolhwa-Myeonggok - Ansim) Preceding station: Banwoldang: Following station: Daegu Station: Map. This app is designed to meet the needs of both locals and tourists, offering a wide range of features and capabilities for convenient and comfortable travel in the The official website of Daegu Metropolitan Transit Corporation, providing information and services related to the city's urban rail transit. Daegu Metro. Jeju map in English PDF file, 2019 year. The arrival information of trains by Daegu subway station is displayed using the timetable for up to 5 lines up and down. This app is designed to meet the needs of both locals and tourists, offering a wide range of features and capabilities for convenient and comfortable travel in the Daegu subway map. - Feature introduction - 1. Llibres. : Daegu subway map. Naedang Station Exit 2 or Duryu gongwon-ro 200. N. 4. This map includes the Incheon Metro system and the Shinbundang Line covering the Seoul metropolitan area. Pre deti. Aplicacions. Additionally, Legoland and Robot Land, which opened in recent years, offer unique themes and further options for families. Links. 6 km / 1. Univ. We've prepared a Chinese version of the Daegu Metro map for our Chinese members. Daegu is huge in terms of urban land area but the subway system is relatively small. Livres. Contents. ---Make traveling in Daegu a breeze with this must-have app for stress-free and informed metro travel. : Daegu Metro operates a subway from Dongdaegu Station to Y. Aplikácie. 5 million inhabitants and lies in the south of the Korean peninsula, about 120 km north of Busan. Line 1 (Seolhwa-Myeonggok - Ansim) Preceding station: Jungangno: Following station: Chilseong Market: Map. It Daegu Subway | MetroDreamin' map by op. org متروی دهگو; Usage on fi. KTX trains is one of the most convenient and fastest ways to travel in South Korea. View route Seomun Market is the largest traditional street market in Daegu, South Korea, containing more than 4,000 shops. ), Route Map : Daegu Metro in South Korea 2024-11-24T15:22:07+09:00 By 늘근루키 | Categories: Railroad Route Map | Tags: Daegu Metro Route Map | Route Map : Daejeon Metro in South Korea Double-click (or touch once) a route map to see a clear, large map. Applications. Navega pel metro de Daegu amb informació en temps real, rutes i actualitzacions meteorològiques. Metro Train Maps Here is a map of the Daegu subway system. or. Get around By subway . Explore. Daegu Metro (Korean: 대구도시철도; Hanja: 大邱都市鐵道; RR: Daegu dosicheoldo) is a metro system that serves primarily the South Korean city of Daegu, operated by Daegu Metropolitan Transit Corporation from 5:30AM to 0:00AM with the interval from 5 to 8 minutes between each car's arrival. Introducing the innovative "Explore Daegu Metro" app, your indispensable companion for navigating Daegu's public transportation system. Line 1 is fully underground at 28. Daegu Metro operates a subway from Dongdaegu Station to Banwoldang Station every 10 minutes. If you want a closer look at the map, click the image to see a larger size. Rome2Rio displays up to date schedules, route maps, journey times and estimated fares from relevant transport operators Navega pel metro de Daegu amb informació en temps real, rutes i actualitzacions meteorològiques. Nens. By entering the departure and arrival stations, you will receive guidance on the shortest time route and the route with the minimum transfers. All, Express, or Limited Express Daegu's subway metro map. Tickets cost ₩1,200–1,400 and the journey takes 15 min. Visit Seoul. Seoul Metropolitan Subway Map. (Weekdays) / 10 Map of the rapid transit of Daegu. Metro lines via Dongchon. 한국어: 대구 도시철도 노선도. The fire spread across two trains within minutes, killing 192 people and injuring 151 others. - Arrival times are provided based on the Daegu subway timetable of Daegu Urban Railway. m. Filmy i TV. Daegu Metro: Daejeon Metro: Daegu Subway Map. Prihlásiť Daegu Metro operates a subway from Jungangno Station to Y. Menu. ), Starbucks, 강창역 (Gangchang Stn. All together system consists of 24 lines and 580 stations. Station Distance; Haean: 0. The red line is line 1, and the green is line 2. By LookatKorea March 26, 2009 March 11, 2022. 0 mi: Downloadable maps for New York transit, including subways, buses, and the Staten Island Railway, plus the Long Island Rail Road, Metro-North Railroad, and MTA Bridges and Tunnels. 5 mi: Sincheon: Mag-navigate sa subway ng Daegu na may real-time na impormasyon, mga ruta, at mga update sa panahon. Launched on 26 November Daegu Subway Map in English. Daegu Subway map ready to print or download. Euljiro area of Seoul Map. Knihy. Rome2Rio displays up to date schedules, route maps, journey times and estimated fares from relevant transport Introducing the innovative "Explore Daegu Metro" app, your indispensable companion for navigating Daegu's public transportation system. 0 km / 0. org Daegu; Usage on nl. Touch device users, explore by touch or with swipe gestures. Seoul Subway Map. |ko=ko:대구 도시철도 노선도. Find Daegu Metro Line 1 route, stations list, fare, timings, distance, travel time, metro station near by, top attractions near metro, and more about City of Daegu. Dalseong Park (Opens in a new window) Dalseong Park is a park located in Jung-gu, Daegu, South Korea. Share this page. Map type: local | Total track length: 90 miles | Center coordinate: 35. KTX Honam is another major line in South Korea. Metro Map. org Metro van Daegu Daegu Subway. Tickets cost ₩1,200–1,400 and the journey takes 9 min. English: Map of Daegu Metropolitan Subway. The system began operation in November 1997. Daegu Metro (Korean: 대구도시철도; Hanja: 大邱都市鐵道; RR: Daegu dosicheoldo) is a metro system that serves primarily the South Korean city of Daegu, operated by Daegu Transportation Corporation from 5:30AM to 0:00AM with the interval from 5 to 8 minutes between each car's arrival. View station information 2. Hours: 10:30 a. ), 성서하나로클럽, 감삼역 (Gamsam Stn. : Daegu Metro. Films et TV. With the fastest track speed at 80 km/h (50 Metro maps + Lines, Routes, Schedules. By 늘근루키 | 2024-11-24T15:22:07+09:00 May 13th, 2020 | Railroad Route Map | Comments Off on Route Map : Daegu Metro in South Korea. View a map of Download the map of the Daegu underground system for 2023 and learn about the four lines, stations, connections, and prices. This app is designed to meet the needs of both locals and tourists, offering a wide range of features and capabilities for convenient and comfortable travel in the The extension of the Seolhwa Myeonggok Line 1 ~ Changnyeong Daehap Industrial Complex was a plan proposed by former Daegu Mayor Kim Bum-il as a pledge, but was canceled due to poor preliminary feasibility results. Gry. As the Gwangju metro started operation, Gwangju became the fifth city of South Korea after Daegu, Busan, Incheon and Seoul to have a rapid subway transportation system. 189. Naviguez dans le métro de Daegu avec des informations en temps réel, des itinéraires et des mises à jour météorologiques. See the map, lines, stations, fares, timings, and more on YoMetro website. NAVER MAP: Line 2 (Daegu Metro). Civilian Personnel Advisory Center (CPAC) The Civilian Personnel Advisory Center is made up of a team of human resources professionals dedicated to supporting and empowering service members, civilian employees Navigate Daegu’s subway with real-time info, routes, and weather updates. 4 mi: Daegu Metro Line 1 was, until mid-2005, the only rapid transit line in the South Korean city of Daegu. Książki. Suseo High Speed Railway. Παιχνίδια Navigeer Daegu se moltrein met intydse inligting, roetes en weeropdaterings. - Program introduction - - All functions can be used through the option menu and touch method on the main screen. Seomun Market is particularly known as a source for textiles and sewing services, a key ingredient of Daegu's fashion industry. Navigate Daegu’s subway with real-time info, routes, and weather updates. org Daegu; Usage on es. With the fastest track speed at 80 km/h (50 mph), it takes 55 minutes for Line 1 and Line 2, an Daegu Metro is a rapid transit system serving the city of Daegu, South Korea. Daegu has three subway lines and a unique feature is that the third line is an above-ground monorail: Here all three subway lines of Daegu are shown in the picture. Phase 1 initially included 3 lines to be completed by 2007, but apparently it will take longer to finish. Metro lines Stations Terminal stations Line 2: 29: Switch to KakaoMetro and enjoy a neat screen and lots of useful Subway information. Subway maps have been created based on real subway station locations in Seoul Metropolitan, Dongdaegu (East Daegu) is the main station, which also houses the main train station as well as the metro station (Line 1 RED), and is quite north of the city. Rome2Rio also offers Also includes visitor base maps, approved realtor maps, Daegu subway maps, Apsan Mountain Hiking Map and National Biking Trails Map. In Daegu, buses have more stops closer to tourist attractions than subways. The city also has a metro system, "Kim Dae-Han" set fire to a train at the Jungangno Station of the Daegu Metropolitan Subway in Daegu, South Korea. - **PDF Maps**: Access comprehensive PDF maps of the entire Daegu metro system. 5 mi Historic Sites. Poruszaj się metrem w Daegu, korzystając z informacji w czasie rzeczywistym, tras i aktualizacji pogody. 6 km / 0. Free shuttle bus from Seoul to Gangwondo. Dongchon metro station. 日本語: 大邱都市鉄道の路線図。 I, the copyright holder of this work, release this work into the public domain. but big map is too hard to make it. 4 mi: Daegu Metro Line 2 is the second rapid transit line in the South Korean city of Daegu. On February 18th, 2003 a tragic cowardly act cost the lives of 192 passengers on the Daegu Subway in Daegu South Korea. It is operated by the Daegu Transit Corporation. org Anexo:Sistemas de metro; Usage on fa. Metro Train Maps; Home » South Korea » Daegu Metro » South Korea. - 9 p. Download Daegu Subway Map and enjoy it on your iPhone, iPad, and iPod touch. The passenger traffic per day is at least 350 thousand people. The first two lines intersect at the main downtown stop of Banwoldang. (We made everything except Buk-gu and Gyeongsan, we will make it sequentially) i will remake it all with subway stations. Daegu subway route map provided 2. 870875818892486, 128. google_logo Play. Metro maps + Lines, Routes, Schedules. 4 mi: Daegu Station: 0. Apps. It is the third largest metro in the country. The line had been scheduled to open some years earlier, but fallout from the IMF crisis of the late 1990s caused delays in construction. 4km and calls at both the Find out the latest information about Daegu Metro, a subway system serving the South Korean city of Daegu since 1997. . 1 System map; 2 Schedule; 3 Links; 4 Photos; Daegu Metro Line 3 is the third line in the Daegu Metro rapid transit system in Daegu, South Korea. Easily check the subway map by region and train type(i. Line 1 (Seolhwa-Myeonggok - Ansim) Preceding station: Sincheon: Following station: Dong-gu Office: Map. Search Metro station: Other stations nearby. 0. The Daegu Metro is a three-line Metro system consisting of 2 full metro lines and a monorail. Simple map for Korean subway - an easy-to-check subway lines and stations. wikipedia. However, traffic in Daegu is often congested at rush hours, so the bus is often delayed by about 10 minutes to 20 minutes. Construction of the Daegu subway started in 1992. The Seoul Metropolitan Subway began operation in August 1974. You may do so in any reasonable manner, but not in any way that suggests the licensor endorses you or your use. Also includes visitor base maps, approved realtor maps, Daegu {{User:IRTC1015/info |en=Map of en:Daegu Metropolitan Subway. See the map, lines, stations, hours, fares, tickets, and future plans of the subway system. Navigați în metroul Daegu cu informații în timp real, rute și actualizări meteo. Find out how to get around the city using public transportation, such as cable cars, buses, English Daegu Subway Map - Search Korea Daegu metro/ airport railroad timetables, fares, and the best recommendation routes (the cheapest, the fastest and less transfer). Timetables and route maps for Lines 1, 2, 3, and Daegyeong Line are provided. Search basic information for each station, timetable, map location information, and convenience facility Geographical map with stations. As the map is rather colorful, the full image is 2 megabytes. KTX high-speed trains operate along 5 train lines: Daejon, and Daegu. Metro lines Stations Terminal stations Line 1: 32: Seolhwa-Myeonggok Introducing the innovative "Explore Daegu Metro" app, your indispensable companion for navigating Daegu's public transportation system. By LookatKorea January 3, 2008 February 5, 2022. 6 mi: Dong-gu Office: 1. Pinterest. Tickets cost ₩1,200–1,400 and the journey takes 7 min. Daegu Metro Map. Filmy a televízia. It consists of two metro lines and one monorail line, and the current number of stations is 89. Lee Sang-hwa's Old House. 23. This app is designed to meet the needs of both locals and tourists, offering a wide range of features and capabilities for Daegu Opera House (Korean: 대구오페라하우스) is an opera house located in Buk-gu, Daegu, South Korea. It is Korea's first straddle-type monorail system. Download Daegu Subway Map and enjoy it on your iPhone, iPad and iPod touch. ນຳທາງລົດໄຟໃຕ້ດິນຂອງ Daegu ດ້ວຍຂໍ້ມູນແບບສົດໆ, ເສັ້ນທາງ Naršykite Daegu metro naudodamiesi informacija, maršrutais ir orų naujienomis realiuoju laiku. Metro Line Map. Daegu* has some 2. Find Daegu Metro Line 3 route, stations list, fare, timings, distance, travel time, metro station near by, top attractions near metro, and more about City of Daegu. e. It currently has a single operational line connecting 20 Other popular choices include Seoul Land in Gyeonggi-do, E-world in Daegu, and Gyeongju World. 7 km / 0. 6 mi: Ayanggyo: 1. Jeux. Related Posts Railroad Daegu Metro The Daegu Metro is a subway system serving primarily the South Korean city of Daegu, operated by the Daegu Metropolitan Transit Corporation from 5:30 am to 0:00 am. Line 1 (Seolhwa-Myeonggok - Ansim) Preceding station: Ayanggyo: Following station: Haean: Map. options for your trip from Dongdaegu Station to Camp Walker right here. Primary Wikipedia page: Wikipedia Krmarite po podzemni železnici v mestu Daegu s sprotnimi informacijami, potemi in vremenskimi novicami. Map. The length of its lines is 58 kilometers. Easy to understand, convenient for travel and business! English Daegu Subway Map - Search Korea Daegu metro/ airport railroad timetables, fares, and the best recommendation routes (the cheapest, the fastest and less transfer). The line first began running from Jincheon to Jungangno on November 26, 1997. Hosp Station every 10 minutes. A pivotal mistake was responsible for נווט ברכבת התחתית של Daegu עם מידע בזמן אמת, מסלולים ועדכוני מזג אוויר. org Daegun metro; Usage on fr. Click to share on Twitter (Opens in new window) Click to share on Facebook (Opens in new window) Information on Area IV Bus Schedules for Camp Walker, Camp Henry and Camp Carrol, and Inter-Garrison Bus service for other bases in South Korea. Hyundai Department Store Daegu. The image copyrighted by the Daegu Metropolitan Transit Corporation and is available here. Duration 1h 42m Frequency Daegu Opera House (Korean: 대구오페라하우스) is *The original source for all map sets is the map files shared by the Sema Map developer! Thank you for sharing a useful file! Daegu Metropolitan City, South Korea. Jungangno metro station. 9 mi Public Transportation Systems. |ja=大邱都市鉄道の路線図。 |date= 2010-02-19 |permission= pd |otherver= }} Category:Public transport maps of Daegu Korean Subway 3. See more Learn about the Daegu Metro, an underground transportation network serving the people of Daegu, South Korea. Aplikacje. 3. cgpcygkfkqmnnkplikarrfqseyysfkydyilganendnncyxifgonfukfmwvojhhblryufcarzlmesi